230 likes | 461 Views
dengue virus. WHO: 50 - 100 million cases/yr. Sharon Isern, PhD Yancey Hrobowski, PhD Joshua Costin, PhD Kelli Barr, PhD Krystal Fontaine Craig Rees Cindo Nicholson Robert Garry, PhD - Tulane University Ram Samudrala, PhD - University of Washington Tom Monath, PhD - Acambis
E N D
dengue virus WHO: 50 - 100 million cases/yr
Sharon Isern, PhD Yancey Hrobowski, PhD Joshua Costin, PhD Kelli Barr, PhD Krystal Fontaine Craig Rees Cindo Nicholson Robert Garry, PhD - Tulane University Ram Samudrala, PhD - University of Washington Tom Monath, PhD - Acambis Michael Holbrook, PhD - UTX, Galveston Elizabeth Hunsperger, PhD - CDC, San Juan ONR /DTRA /US Army / NIH Acknowledgements
Development of novel virus entry inhibitors virus host cell inhibitor entry blocked
Dengue Plaque Assay control control peptide 57IIb peptide 80FP peptide 81IIb peptide 59PA
Effect of dengue inhibitory peptides on Sindbis virus infectivity
DENV-2 MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY DENV-1 -------------I------V--LI--I--TA- DENV-3 -------------V---LN-L--MV--I--SA- DENV-4 -----E-------V---L--L---V-----SV- WNV L-A----------V----------V-----GAF YFV L-VM--V----S-A--F------GI-T---SAF SLEV L-V----------I------I---------GAF JEV L-A----------I----N-I---V-----GAF RSSEV LTVI-EH------T--FL--------T-L-GAF CEEV LTVI-EH------A--FLS-I-----T-L-GAF