1 / 2

adam33 antibody

Anti-ADAM33 polyclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-ADAM33-PAb-191499-147.htm<br>

creatived11
Download Presentation

adam33 antibody

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Anti-ADAM33 (aa 551-650) polyclonal antibody Anti-ADAM33 (aa 551-650) polyclonal antibody (DPAB-DC3319) (DPAB-DC3319) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. Immunogen Immunogen ADAM33 (NP_079496, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. The sequence is AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALAL PSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Conjugate Conjugate Unconjugated Applications Applications WB (Recombinant protein), ELISA, Size Size 50 μl Buffer Buffer 50 % glycerol Preservative Preservative None Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION GENE INFORMATION Gene Name Gene Name ADAM33 ADAM metallopeptidase domain 33 [ Homo sapiens (human) ] Official Symbol Official Symbol ADAM33 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved

  2. Synonyms Synonyms ADAM33; ADAM metallopeptidase domain 33; C20orf153; DJ964F7.1; disintegrin and metalloproteinase domain-containing protein 33; ADAM 33; a disintegrin and metalloprotease 33; a disintegrin and metalloproteinase domain 33; disintegrin and reprolysin metalloproteinase family protein; Entrez Gene ID Entrez Gene ID 80332 Protein Refseq Protein Refseq NP_001269376 UniProt ID UniProt ID A2A2L3 Chromosome Location Chromosome Location 20p13 Function Function metalloendopeptidase activity; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved

More Related