20 likes | 22 Views
Mouse anti-ZMYND8 monoclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/zmynd8-antibody-266862-144.htm<br>
E N D
Mouse anti-Human ZMYND8 monoclonal antibody, Mouse anti-Human ZMYND8 monoclonal antibody, clone 6C23 (CABT-B11837) clone 6C23 (CABT-B11837) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Immunogen Immunogen PRKCBP1 (NP_898869, 601 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype Isotype IgG1 Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Clone Clone 6C23 Conjugate Conjugate Unconjugated Applications Applications WB, IHC, sELISA, ELISA Sequence Similarities Sequence Similarities DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKAS PEPEKDFSEKAK PSPHPIKDKLKGKDETDSPTVHL Format Format Liquid Buffer Buffer In 1x PBS, pH 7.2 Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. BACKGROUND BACKGROUND Introduction Introduction The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] Keywords Keywords ZMYND8; zinc finger, MYND-type containing 8; RACK7; PRKCBP1; PRO2893; protein kinase C- binding protein 1; CTCL tumor antigen se14-3; predicted protein of HQ2893; zinc finger MYND 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
domain-containing protein 8; cutaneous T-cell lymphoma-associated antigen se14-3; GENE INFORMATION GENE INFORMATION Entrez Gene ID Entrez Gene ID 23613 UniProt ID UniProt ID Q9ULU4 Function Function RNA polymerase II transcription corepressor activity; kinase activity; metal ion binding; protein binding; repressing transcription factor binding; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved