1 / 2

prkcbp1

Mouse anti-ZMYND8 monoclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/zmynd8-antibody-266862-144.htm<br>

creatived11
Download Presentation

prkcbp1

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Mouse anti-Human ZMYND8 monoclonal antibody, Mouse anti-Human ZMYND8 monoclonal antibody, clone 6C23 (CABT-B11837) clone 6C23 (CABT-B11837) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Immunogen Immunogen PRKCBP1 (NP_898869, 601 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype Isotype IgG1 Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Clone Clone 6C23 Conjugate Conjugate Unconjugated Applications Applications WB, IHC, sELISA, ELISA Sequence Similarities Sequence Similarities DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKAS PEPEKDFSEKAK PSPHPIKDKLKGKDETDSPTVHL Format Format Liquid Buffer Buffer In 1x PBS, pH 7.2 Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. BACKGROUND BACKGROUND Introduction Introduction The protein encoded by this gene is a receptor for activated C-kinase (RACK) protein. The encoded protein has been shown to bind in vitro to activated protein kinase C beta I. In addition, this protein is a cutaneous T-cell lymphoma-associated antigen. Finally, the protein contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] Keywords Keywords ZMYND8; zinc finger, MYND-type containing 8; RACK7; PRKCBP1; PRO2893; protein kinase C- binding protein 1; CTCL tumor antigen se14-3; predicted protein of HQ2893; zinc finger MYND 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved

  2. domain-containing protein 8; cutaneous T-cell lymphoma-associated antigen se14-3; GENE INFORMATION GENE INFORMATION Entrez Gene ID Entrez Gene ID 23613 UniProt ID UniProt ID Q9ULU4 Function Function RNA polymerase II transcription corepressor activity; kinase activity; metal ion binding; protein binding; repressing transcription factor binding; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved

More Related