'Positive scores' presentation slideshows

Locality 3 breakdown Derbyshire Community Health Services NHS Foundation Trust January 2019

NHS National Staff Survey 2018. Locality 3 breakdown Derbyshire Community Health Services NHS Foundation Trust January 2019. Introduction Response rates Core survey results breakdown Demographics Appendix: How your scores are calculated. Contents. Introduction. Section 1.

5.35k views • 534 slides

Locality 2 breakdown Derbyshire Community Health Services NHS Foundation Trust January 2019

NHS National Staff Survey 2018. Locality 2 breakdown Derbyshire Community Health Services NHS Foundation Trust January 2019. Introduction Response rates Core survey results breakdown Demographics Appendix: How your scores are calculated. Contents. Introduction. Section 1.

2.22k views • 222 slides

Solving Classification Problems for Symptom Validity Tests with Mixed Groups Validation

Solving Classification Problems for Symptom Validity Tests with Mixed Groups Validation. Richard Frederick, Ph.D., ABPP (Forensic) US Medical Center for Federal Prisoners Springfield, Missouri. I am not a neuropsychologist. My view of brain. Your view of brain. My board certifications:.

1.94k views • 181 slides

Staff Survey 2017

Staff Survey 2017. Derbyshire Community Health Services NHS Foundation Trust Locality Report: Estates January 2018. Picker is an international charity dedicated to ensuring the highest quality health and social care for all, always. We are here to:

1.17k views • 104 slides

Safeguarding and looked after children

374 views • 26 slides

Climate Predictability Tool

Climate Predictability Tool. Simon Mason International Research Institute for Climate and Society The Earth Institute of Columbia University. What is CPT?. Climate Predictability Tool (CPT) is an easy-to-use Windows-based software package for making downscaled seasonal climate forecasts.

783 views • 24 slides

Scoring Matrices

Scoring Matrices. Scoring matrices, PSSMs, and HMMs. Reading: Ch 6.1. BIO520 Bioinformatics Jim Lund. Alignment scoring matrix. DNA matrix: A C G T A 5 -4 -4 -4 C -4 5 -4 -4 G -4 -4 5 -4 T -4 -4 -4 5. Alignment scoring matrix. Protein matrix:. Use of a scoring matrix.

495 views • 23 slides

Sequence alignment

Sequence alignment. SEQ1: VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR SEQ2:

221 views • 9 slides