20 likes | 29 Views
Anti-AGPAT2 polyclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-AGPAT2-Pab-217908-147.htm
E N D
Anti-AGPAT2 (full length) polyclonal antibody Anti-AGPAT2 (full length) polyclonal antibody (DPABH-09913) (DPABH-09913) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Immunogen Immunogen Full length protein corresponding to Human Agpat2 aa 1-278. (NP_006403.2).Sequence: MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLL RHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQS ILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAM TVMADLGERMVRENLKVW Isotype Isotype IgG Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Purification Purification Protein A purified Conjugate Conjugate Unconjugated Applications Applications WB Format Format Liquid Size Size 50 μg Buffer Buffer pH: 7.20; Constituent: 100% PBS Storage Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. GENE INFORMATION GENE INFORMATION Gene Name Gene Name AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [ Homo sapiens ] Official Symbol Official Symbol Agpat2 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
Synonyms Synonyms AGPAT2; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); Berardinelli Seip congenital lipodystrophy; BSCL; 1-acyl-sn-glycerol-3- phosphate acyltransferase beta; LPAAT beta; 1-AGPAT 2; 1-AGP acyltransferase 2; lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; 1- acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase-beta); BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta; Entrez Gene ID Entrez Gene ID 10555 mRNA Refseq mRNA Refseq NM_001012727 Protein Refseq Protein Refseq NP_001012745 MIM MIM 603100 UniProt ID UniProt ID A0A024R8F9 Chromosome Location Chromosome Location 9q34.3 Pathway Pathway Adipogenesis; CDP-diacylglycerol biosynthesis I; Fat digestion and absorption; Fatty acid, triacylglycerol, and ketone body metabolism; Glycerolipid metabolism; Function Function 1-acylglycerol-3-phosphate O-acyltransferase activity; transferase activity, transferring acyl groups; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved