1 / 2

Quiz#8 LC710 10/20/10 name___________

Quiz#8 LC710 10/20/10 name___________. Q1 (3pts) : I have the UBX homeodomain sequence and want to determine ( in vivo ) the optimal binding sites. I know that TAATTG is a good in vitro binding site and know that TAAT is absolutely

brittania-sellers
Download Presentation

Quiz#8 LC710 10/20/10 name___________

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Quiz#8 LC710 10/20/10 name___________ Q1 (3pts) :I have the UBX homeodomain sequence and want to determine (in vivo) the optimal binding sites. I know that TAATTG is a good in vitro binding site and know that TAAT is absolutely reguired for UBX binding. Using the two plasmids below (you may modify them at will) and a third one that you need to make, please design a clever experiment to look for the best binding sites. is TATA minimal promoter Please add modifications to plasmids #1 Red F.P. #2 Green F.P. CMV is Eukaryotic promoter CMVp #3 MCS Please write it in the form of an outline

  2. Q2: (2pt) Below is the UBX DNA binding portion of the protein. You want to fuse it VenusFP. : UBX: Nt-RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQ* -Ct Genetic Code Phe-TTC Leu-CTG Ile-ATC Met-ATG Val-GTG Ser-TCT Pro-CCC Thr-ACT Ala-GCC Tyr-TAT His-CAT Gln-CAA Asn-AAT Lys-AAA Asp-GAT Glu-GAA Cys-TCT Trp-TGG Arg-CGA Gly-GGT *(stop)-TAA VenusFP: Nt-MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICT TGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNH YLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*-Ct Write out the -9 to +9 nucleotides around the junction 5’ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 3’ Q3: (2pt) You want to mutate Phe3 to Tyr3 in VenusFP. Briefly List two Different techniques to achieve this mutation. Which is faster A or B? A) B)

More Related