1 / 51

Vom Geschmackstest zur Personalisierten Medizin Diagnostik - Evolution - Revolution

Fortbildung Diagnostik Wenn das Ganze mehr ist als die Summe seiner Teile… 21./22. Oktober 2009, Yverdon-les-Bains Roche Diagnostics (Schweiz) AG. Vom Geschmackstest zur Personalisierten Medizin Diagnostik - Evolution - Revolution. Prof. Dr. Beda M. Stadler

ciaran-guy
Download Presentation

Vom Geschmackstest zur Personalisierten Medizin Diagnostik - Evolution - Revolution

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Fortbildung Diagnostik Wenn das Ganze mehr ist als die Summe seiner Teile… 21./22. Oktober 2009, Yverdon-les-Bains Roche Diagnostics (Schweiz) AG Vom Geschmackstest zur Personalisierten MedizinDiagnostik - Evolution - Revolution Prof. Dr. Beda M. Stadler Institut für ImmunologieInselspital, Bern

  2. Diagnostik einst Diagnose oder Blick in die Kristallkugel?

  3. Diagnostik heute Lebensqualität - Lebenssinn

  4. MHC Missmatch riechen (3)

  5. Q&A

  6. Principal Uses of Diagnostics Across The Health Care Continuum von Gesundheit zu Wellness

  7. Wenn das Ganze mehr ist als die Summe seiner Teile… Die medizinische Forschung hat so enorme Fortschritte gemacht, dass es überhaupt keine gesunden Menschen mehr gibt.- Aldous Huxley Die Fortschritte der Medizinsind ungeheuer. Man ist seines Todes nicht mehr sicher.- Hermann Kesten 7

  8. Expanding Areas of Scientific Inquiry Sicherheit oder Wahrscheinlichkeit?

  9. Aussagekraft neuer Diagnoseverfahren Kennt er seine Blutgruppe?

  10. Die Informationsflut gestern morgen 100‘000‘000‘000 Bytes/Tag(= 20‘000 x Shakespeares Werk) 1 Byte/Tag

  11. Die Sequenzflut Genetics Genomics

  12. PCR SNPProfil DNA-Chip Sequenz • Dosis • Nebenwirkungen • Resistenzen Individualisierte Behandlung Zu viel versprochen?

  13.  + =  + =   + = SNPs & Pharmacogenetics “If it were not for the great variability among individuals Medicine might as well be a science and not an art. Sir William Osler, 1892

  14. z.B. Tumorresistenz   From: Esteller M, et al. Inactivation of the DNA-repair gene MGMT and the clinical response of gliomas to alkylating agents. NEJM 243:1350-1354, 2000.

  15. … und zu teuer

  16. von der Sequenzzur Struktur in silico Verstehen wir die Moleküle? • Bindung analysieren • Funktion verstehen • Docking-Simulation(Rational drug design)

  17. Rechenkapazität: 1 Million PC's Memory-Bandbreite:>100 TeraByte/s Strukturvorhersage noch nicht möglich • "de novo"-Modelling • Extreme Anforderungen an Rechenkapazität • Zur Zeit nur für kleine Proteine (<50 aa) • Entwicklung spezieller Hardware (BlueGene)

  18. Array Systeme in der Diagnostik

  19. Allergen Family: Birch ... clinically well known 19

  20. Cross-reactivity andSequence Similarity Bet v 1 - cluster ALL1_APIGR Api g 1 celery ALL2_APIGR Api g 2 BV1A_BETVE BV1B_BETVE BV1C_BETVE BV1D_BETVE BV1E_BETVE BV1F_BETVE Bet v 1 birch BV1G_BETVE BV1J_BETVE BV1K_BETVE BV1L_BETVE BV1M_BETVE DAU1_DAUCA Dau c 1 carrot MAL1_MALDO Mal d 1 apple MPA1_CARBE Car b 1 hornbeam MPA2_CARBE Car b 1 MPAA_CORAV Cor a 1 hazelnut MPAG_ALNGL Aln g 1 alder PRU1_PRUAR Pru ar 1 apricot PRU1_PRUAV Pru av 1 cherry PYR1_PYRCO Pyr c 1 pear Sequence-based Clustering 20

  21. Good and Bad Sequence Alignments ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNGTTMTLPATTLTLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDL Sequence basedalignment Structure basedalignment 21

  22. Sequence - Structure Relationship Screw Washer Screw nut Spring Ball bearing Special 22

  23. Sequence-Structure Relationship [FY]-x-C-x-[VA]-x-H Domain (Fold): Sequences: Sequence Motif: 23

  24. Automatic Identificationof Allergen Profiles Dataset remainingsequences Adb motif discovery(MEME) motif collect removematches search dataset Motives Matches 24

  25. New Public Motif Database 2003 2004* 2005* 1st Analysis further Analysis Sequences (origin) own search Sequences (#) 779 876 1102 Motifs 52 64 69 non-matching seqs 135 169 190 Publication The FASEB Journal. 2003;17:1141-1143 * In collaboration with Adriano Mari, Allergy Data Laboratories p.s.c. 25

  26. Motif-basedAllergenicity Prediction RDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRT query protein motifmatch? yes 52motifs allergens: no pairmatch? yes 135sequences no non-allergen allergen 26

  27. Allergen Extracts Contain Several Motifs Cross reactivity: Motif 4

  28. Vorhersage plus Messung? Useonlyrecombinantallergens Predictmore allergen sensitizationsbymotifs 28

  29. The Bioinformatic Crystal Ball Useonlyrecombinantmotifs motifs Predict all allergen sensitizations? 29

  30. Tropomyosinsan Ubiquitous Allergen Periplaneta america Per a 7 Chironomus kiiensis TPM Panulirus stimpsoni Pan s 1 Dermatophagoides pteronyssinus TPM Homarus americanus Hom a 1 Lepidoglyphus destructor TPM Metapenaeus ensis Met e 1 Herring worm TPMM Human TPM3 gamma chain Pacific oyster TPM Rabbit TMP2 beta chain Turbo cornutus Tur c 1 Pig TPM1 alpha chain Chicken TPM1 alpha chain Streptococcus pyogenes 6 M protein Streptococcus pyogenes 5 M protein 30

  31. Wir sind beinahe Klone Unsere Gene, Basis des Immunsystems 31

  32. Immunsystem - tägliche Evolution … und Ursache der meisten Krankheiten 32

  33. Genrearrangement HC-Gensegmente m d g3 e a2 g1 a1 g2 g4 B Zelle VH DH JH VL JL k l H-Kette LC-Gensegmente L-Kette 33

  34. Antikörperspezifität B Zelle Antikörper Epitop eines Antigens eine B Zelle =ein Antikörper = ein Idiotyp 34

  35. Theoretische Rekombinationen H Kette Gensegmente L Kette Gensegmente L/H Ketten Diversität V 200 100 20‘000 D 20 0 400‘000 J 6 5 12‘000‘000 D-frame 0.33 - 4‘000‘000 Nur ein Frame! = 30% Reduktion J-frame 0.33 0.33 ~450‘000 Nukleotide einfügen (Durchschnitt 6) ~1 ·1014 ~1 ·1019 Nukleotid Verlust (meist <=7) ~1018 Nur ein Frame! = 30% Reduktion 1 Million Genmanipulationen pro Sekunde

  36. Gegen jeden Antikörperein Anti-Idiotyp Antigen Antikörper Anti-Idiotyp Das Idiotypen-Anti-Idiotypen Netzwerk 36

  37. Den idealen Partner finden? 109-1012 Antigene 109-1012 Antikörper 109 Menschen 37

  38. Suche nach dem idealen Partner Kontaktzeit eine Stunde Kontaktzeit Zehn Sekunden Jahre Weltbevölkerung (Millionen)

  39. Nicht zimperlich bei der Wahl 39

  40. Meme und Gene Kein bekannter Speicherort

  41. Stehen wir am selben Wendepunkt?

  42. Immunität und Infektiositätvon Memen Immunologische Diversität benutzt nicht Gene, sondern rearrangiert Gensegmente.

  43. Nicht-Wissen macht stark!?! • „Beethovens Fünfte“ Mem • Wer es nicht kennt, ist ein Kulturbanause • Eben wurden Sie angesteckt vom „Genrearrangement Mem“ • Sind nicht infizierteKulturbanausen? • Immunität gegen Meme • Krankheit oder Schutz

  44. Wer definiert die Gesundheit? Wie viel Gesundheit? Gesund sterben Gesundheit oder Wellness?

  45. Gesundheit des Menschen laut WHO „ … ein Zustand des vollständigen körperlichen, geistigen und sozialen Wohlergehens und nicht nur das Fehlen von Krankheit oder Gebrechen.“

  46. Evidence Based Medicine Dürfen Medikamente ohne Wirkung verkauft werden? Dürfen Medikamente ohne Wirkstoffe verkauft werden? Antwort: Der Doppelblindversuch ist die wichtigste Errungenschaft unseres Jahrhunderts 46

  47. Wer profitiert von der Wellness?

  48. Wer entscheidet über die Labordiagnostik? Moderne Entscheidungshilfen

  49. Wo wäre die Labormedizin heute? Wissenschaftlicher Fortschritt 1000 v.Chr. 1 1000 n.Chr. 2000 n.Chr. Ägypter Griechen Römer Renaissance Moderne Christliches Mittelalter Aufklärung

  50. From Diagnosis to Patient Outcomes 1. Is a particular diagnostic test accurate for the target condition? 2. Does diagnostic use result in adverse effects or harms? 3. Do treatments change intermediate health outcomes? (e.g., cholesterol levels, tumor size) 4. Do treatments/health interventions result in adverse effects? 5. Are changes in intermediate outcomes associated with changes in health outcomes? 6. Does treatment improve health outcomes? 7. Is there direct evidence that diagnostic use improves health outcomes? Source: Adaptedfrom Harris, Helfand, Woolf, et al. 2001.

More Related