1 / 50

Nematodes

Nematodes. Parijat S Juvale Department of Plant Pathology and Microbiology Room No. 429, Bessey Hall parijat2@iastate.edu. Nematodes are extremely abundant and diverse. Variable size: 0.2 mm to over 3 m Found in virtually all the ecosystems. Over 20,000 species have been described.

kalliyan
Download Presentation

Nematodes

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Nematodes Parijat S Juvale Department of Plant Pathology and Microbiology Room No. 429, Bessey Hall parijat2@iastate.edu

  2. Nematodes are extremely abundant and diverse • Variable size: 0.2 mm to over 3 m • Found in virtually all the ecosystems. • Over 20,000 species have been described. • Numerically extremely dominant, over 80% of all living animals on earth are nematodes! • Grouped into a phylum “Nematoda”

  3. Figure 2. The relationships of the Nematoda. Blaxter M (2011) Nematodes: The Worm and Its Relatives. PLoS Biol 9(4): e1001050. doi:10.1371/journal.pbio.1001050 http://www.plosbiology.org/article/info:doi/10.1371/journal.pbio.1001050

  4. Adaptation for parasitism: Stylet

  5. Plant parasitic nematodes

  6. Cyst Nematodes (Heterodera & Globodera) Root-Knot Nematodes (Meloidogyne) Sedentary endoparasites Family Heteroderidae

  7. SCN and RKN distribution in USA

  8. Soybean root showing SCN cysts Tomato root system galled by root-knot nematode

  9. Life cycle Six stages (egg, 4 juvenile stages, and adult)

  10. Feeding Sites Formation

  11. Gland Cells

  12. - Extensive endoreduplication - Increased cytoplasmic density - Cell wall degradation - Breakdown of large vacuoles - Increased numbers of organelles - High metabolic activity

  13. Feeding Sites Syncytium Giant-Cells • Fused cells • Dense cytoplasm • Cell wall changes • No nuclear division • No cell division • Discrete and enlarged cells • Dense cytoplasm • Cell wall changes • Nuclear division without cytokinesis • No cell division

  14. Giant-Cells

  15. Syncytium

  16. Identifying nematode effectors

  17. Parasitism Genes: Nematode Effectors The genetic determinants that enable a nematode to infect plants • Parasitome ParasitismGenes Parasitism Proteins

  18. Construction of gland-specific cDNA libraries Detection and collection of the gland cells Microaspiration of esophageal gland cell cytoplasm

  19. Signal peptide prediction N-terminal sequence that targets proteins to ER and the secretory pathway MNWMHYCLIACFSIYYFNTVESSTINSVTVQVNKIENNEKGRQFNLKFTNQVYERVCHVDFRVDLPDTAKLDKYSKMVPIPDTCGQYALPKSLDLLPGETFDAQLTLLGHDGKPNVTVLNTNNIPTSKQCKK- Evidences for Secretion -Enzymes without substrates (cellulase and pectinase) -Enzymes without pathway (chorismatemutase, shikimate pathway) Putative Function Assignment -Similarities are with other parasitic nematodes, bacteria, fungi or plants but not with proteins from C. elegans

  20. High expression level during parasitic stages Developmental expression profile of CBP in H. schachtii These criteria allowed the identification of more than 50 putative parasitism proteins Huang et al. MPMI Vol. 16, No. 5, 2003, pp. 376–381. Gao et al. MPMI Vol. 16, No. 8, 2003, pp. 720–726.

  21. Experimental Approaches for Functional Characterization of Nematode Effectors

  22. 1-Developmental expression profile High expression level during parasitic stages

  23. 2-in situ hybridization Detection of 10A7 mRNA in dorsal gland cells mRNA in situ hybridization of a cellulase probe to transcripts expressed specifically within the two subventral esophageal gland cells

  24. Secretion of cellulase (green fluorescence) associated with cell wall degradation along the migratory path of the J2 Wang, et al. 1999; 12:64-67

  25. 4 Intracellularlocalization of the effectors Plasma membrane Nuclear Cytoplasmic Plastids

  26. 5-Plant Expression of Parasitism Genes Transgenic Arapidopsis expressing a nematode Clavata3-like gene showing an arrested shoot apical meristem Wang et al.,, Molecular Plant Pathology 2005;6:187-191. C24 CBP Expression of a nematode parasitism gene in plant tissues stimulated root growth

  27. 5-Plant Expression of Parasitism Proteins WT 10A06ox WT 10A07ox 32E03ox WT

  28. 5-Plant Expression of Parasitism Proteins A Plasmodium‐like virulence effector of the soybean cyst nematode suppresses plant innate immunity New Phytologist21643, 6 JUN 2016 DOI: 10.1111/nph.14047http://onlinelibrary.wiley.com/doi/10.1111/nph.14047/full#nph14047-fig-0003

  29. 6-Mutant Complementation Chorismate mutase complementation CLV3 Complementation minimal medium without supplemental phenylalanine and tyrosine A CM deficient E coli strain transformed with a plasmid containing CM coding region was streaked on the top half of the petri dish The same CM-deficient E. coli strain containing only the plasmid was streaked at the bottom half of the plate (Vector) A fully restored clv3-1 mutant expressing nematode CLV3-like gene Arabidopsis wild-type Arabidopsis clv3-1 mutant Lambert et al. MPMI, 1999; 12:328–336. Wang et al.,, Molecular Plant Pathology 2005;6:187-191.

  30. 7-Gene Silencing Plant host-derived RNAi is used to silence the expression of the parasitism genes Expression of 16D10 dsRNA in Arabidopsis resulted in resistance effective against the four major RKN species Huang et al. (2006)103:14302-14306.

  31. 8-Determination of Nematode Susceptibility Enhanced nematode susceptibility in the transgenic plants expressing nematode effectors

  32. Prey Prey Spermidine Synthase (SPDS1) Spermidine Synthase (SPDS2) Bait 10A06 Lamin C Hs-RFCP Lamin C Vector Vector SD/-Leu/-Trp SD/-Leu/-Trp/-Ade/-His BiFC assay Bright Field Bait 10AO6 YFP Lamin C Vector SD/-Leu/-Trp SD/-Leu/-Trp/-Ade/-His Overlay 9-Search for Interacting Proteins 10A06 interacts specifically with Spermidine Synthase 2

  33. 10-Characterization of the interacting proteins Promoter lines, Overexpression, Mutant Lines, … 4 dpi 7 dpi 14 dpi Pro-PK Pro-IAA16

  34. Functions of Nematode Effectors

  35. Functions of Parasitism Proteins Nematodes need to penetrate and migrate through the roots ! 1- Cell wall-digesting enzymes Cellulase (Obtained from either bacteria or fungi by HGT) Pectinase Cellulose-binding protein Expansins

  36. Functions of Nematode Effectors Nematodes need to change plant metabolism in the infected cells! 2-Metabolic Pathway Enzymes ChorismateMutase

  37. ShikimatePathway Chorismate Tryptophan CM Tyrosine Phenylalanine Prephenate Functions of Nematode Effectors Chorismate Mutase (CM)

  38. Functions of Nematode Effectors Nematodes need to alter plant cell development? 3-Small bioactive peptides CLAVATA3-like peptide Unknown peptide < 3KDa

  39. CLV3 CLV3 CLV3 CLV1 CLV1 P P P P P P P P P P Functions of Nematode Effectors Model for CLAVATA3 Action CLV1 Signal transduction leading to developmental changes Does the cyst nematode use ‘ligand mimicry’ to alter plant cell development?

  40. Functions of Nematode Effectors SCN SYV46 functions as CLAVATA3 clv3-1 mutant SYV46 in clv3-1 wild-type Does the cyst nematode use ‘ligand mimicry’ to alter plant cell development?

  41. Functions of Nematode Effectors 4-Auxin signaling Lee et al., 2011. Plant Physiology Cyst nematode effector 19C07 interacts with the Arabidopsis LAX3 auxin influx transporter

  42. Functions of Nematode Effectors 5-Suppression of host defenses Polyamine biosynthesis An effector 10AO7 specifically interacts and induces SPDS2 activity and alters spermidine level.

  43. A Plasmodium‐like virulence effector of the soybean cyst nematode suppresses plant innate immunity 5-Suppression of host defenses New Phytologist21643, 6 JUN 2016 DOI: 10.1111/nph.14047http://onlinelibrary.wiley.com/doi/10.1111/nph.14047/full#nph14047-fig-0004

  44. 6- Control of Transcriptional Machinery A Meloidogyne incognita effector is imported into the nucleus and exhibits transcriptional activation activity in planta Molecular Plant Pathology30 JUN 2014 DOI: 10.1111/mpp.12160http://onlinelibrary.wiley.com/doi/10.1111/mpp.12160/full#mpp12160-fig-0005

  45. Nematode Resistance Genes

  46. The Rhg4 locus has a gene encoding serine hydroxymethyl transferase (SHMT) Functional validation of SHMT by VIGS, RNAi and complementation. SM Liu et al.Nature000, 1-5 (2012) doi:10.1038/nature11651 Note: This figure is from a near-final version AOP and may change prior to final publication in print/online

  47. Copy Number Variation of Multiple Genes at Rhg1 Mediates Nematode Resistance in Soybean Cook et al.,Science 30 November 2012:vol. 338 no. 6111 1206-1209

  48. Broad Resistance of Mi-1 Gene resistance to the root-knot nematode Meloidogyne incognita Resistance to the potato aphid Macrosiphum euphorbiae

More Related