1 / 1

Plectasin: Nature's Antibiotic Peptide and its Therapeutic Potential

Plectasin is a promising peptide with antibiotic properties derived from fungi. This article explores its characteristics, mode of action, and potential applications in medicine.

Download Presentation

Plectasin: Nature's Antibiotic Peptide and its Therapeutic Potential

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. B Plectasin MQFTTILSIGITVFGLLNTGAFAAPQPVPEAYAVSDPEAHPDDFAGMDANQLQKRGFGCN MKFT -- ISI - IAALAFFAQGIVAAPAPIPEA AAVAAPEAEPKALD -- ELPELQKRGFGCN • EST_GQ0132.E7_K03 • (endopiceasin) *:** :** *:.:.:: * .*** *:*** **: ***.*. : : :********* 100 58 % Similarity toplectasin Plectasin GFGCNGPWD - EDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY GFGCNG - WPFEDDEQCHN HCKTIPGYKGGYCANVGTTCKCY • EST_GQ0132.E7_K03 • (endopiceasin) ****** * *** *******:* ********: * .****

More Related