1 / 1

Isolation of N- linked glycopeptides from plasma

SPEG METHOD [1] COOH H 2 N Capturing to Hydrazide beads COOH COOH H 2 N H 2 N Oxidation (NaIO 4 ) COOH H 2 N COOH COOH H 2 N H 2 N Hydrazide captured glycoproteins Oxidized glycans Mouse plasma + [ 14 C]AG/AT Tryptic digestion COOH H 2 N PNGase F cleavage from beads

andrew
Download Presentation

Isolation of N- linked glycopeptides from plasma

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. SPEG METHOD [1] COOH H2N Capturing to Hydrazide beads COOH COOH H2N H2N Oxidation (NaIO4) COOH H2N COOH COOH H2N H2N Hydrazide captured glycoproteins Oxidized glycans Mouse plasma + [14C]AG/AT Tryptic digestion COOH H2N PNGase F cleavage from beads COOH H2N Washing H2N COOH H2N COOH H2N COOH H2N COOH COOH H2N H2N COOH Released N-linked glycopeptides Tryptic peptides on hydrazide beads H2N COOH H2N COOH H2N COOH Hydrazide beads Glycans Oxidized glycans Isolation of N-linked glycopeptides from plasma Yong Zhou1, Ruedi Aebersold2, and Hui Zhang1,3* 1Institute for Systems Biology, Seattle, Washington 98103, USA 2Institute of Molecular Systems Biology, Swiss Federal Institute of Technology (ETH) Zurich and Faculty of Natural Sciences, University of Zurich, CH-8093, Switzerland 3Department of Pathology, Johns Hopkins Medical Institutes, Baltimore, Maryland 21287, USA OVERVIEW RESULTS Optimizing the recently developed Solid-Phase Extraction of (N-linked) Glycopeptides (SPEG) procedure for blood plasma analysis by spiking in [14C]-labeled human glycoproteins significantly enhanced the specificity and yield of the isolated N-linked glycopeptides. This will improve the sensitivity of discovery of clinical biomarkers from blood. 1.Monitoring each step of SPEG procedure using mouse plasma spiked with [14C]-labeled human blood glycoprotein [14C]-Radioactivity assay offers very similar pattern of coupling efficiency comparing with N-linked glycopeptides quantified with LC-MS/MS and isotopic labeling. Here, the coupling efficiency for different NaIO4 oxidation conditions were determined by either direct [14C]-radioactivity assay of uncoupled fractions post coupling (A) or captured N-linked glycopeptides quantified by LC-MS/MS and isotopic-labeling (B). (C), The CID spectrum of one peptide from spiked human AG with specific M/Z value (2021.8498) and sequence (QDQCIYN#TTIYNVQR). (D), The ASAPRatio of the peptide identified in (C)—it’s abundance in Light (1mM NaIO4) is only 0.2090.013 fold of Heavy (10mM NaIO4), i.e. one fifth. 3. Optimizing each step 4. A flow chart illustrating the optimized peptide-level SPEG procedure 1) Trypsin Digestion: Here, five conditions were tested, including: 100 mM NH4HCO3; 8M Urea in 100 mM NH4HCO3 (original); 8M Urea in 100 mM NH4HCO3, plus 2 mM CaCl2; 0.1% RapiGest in 100 mM NH4HCO3; and 50% TFE (Triflouroethonal) in 100 mM NH4HCO3. INTROCUCTION There is growing interest in discovery of disease biomarkers from blood plasma. For this reason, quantitative analysis of plasma proteins has been the focus of different proteomic technologies. The challenges faced by all quantitative plasma proteomic methods include complexity and the high dynamic range of the plasma sample. Therefore, a desirable proteomic technique for plasma profiling must be sensitive, reproducible, and robust. Recently, we have developed a method for Solid-Phase Extraction of N-linked Glycopeptides (SPEG), and we have shown that analysis of plasma using SPEG improves dynamic range and sensitivity. Here, we optimized each step of the method and developed a standard procedure for plasma analysis using SPEG and mass spectrometry by spiking in two [14C]-labeled human glycoproteins. A), Released [14C] radioactive activities from beads by tryptic digestion; B), PNGase F released [14C] radioactive activities; C), PNGase F unreleased [14C] radioactive activities. METHODS 2) Optimization of PNGase F release and peptide-level SPEG flow by [14C] radioactivity monitoring A), Yield comparison: PNGase F released radioactivity from spiked [14C]-AG between protein-level and peptide-level SPEG; B), Saturation curve of hydrazide resin for glycocapture of digested glycopeptides from 20 l plasma spiked with [14C]-AG. Data shown as percentage of original radioactivity retained on hydrazide resin after overnight coupling; C), Yield of N-linked glycopeptides via peptide-level SPEG by different volume of Affi-gel hydrazide slurry; D), Yield of N-linked glycopeptides via peptide-level SPEG by different amount of PNGase F-- 1.5 l PNGase F (1,250 U, New England Biolabs unit) is enough for 20 l mouse plasma. CONCLUSION Here we’ve described the optimization of a recently developed Solid-Phase Extraction of (N-linked) Glycopeptides (SPEG) procedure for blood plasma analysis by spiking with [14C]-labeled human glycoproteins, which significantly enhances the specificity and yield of the isolated N-linked glycopeptides. After the optimization of each step of the SPEG procedure as discussed above, one new flow of N-linked glycopeptide capture can be drawn out as in Figure 4. The experiments show that 25 µl of hydrazide resin, 10mM NaIO4 for 1 hour at room temperature, and 1.5 µl PNGase F for 14 hours at 37 ˚C yield optimal recovery of N-linked glycopeptides from tryptic peptides coming from 20 µl of mouse blood plasma. The buffer system for trypsin digestion is a critical factor for SPEG specificity and efficiency, with 50% TFE giving the best results. Finally, pre-digestion of plasma proteins using trypsin was shown to be one effective way to significantly increase the yield of SPEG. These results will improve the sensitivity of discovery of clinical biomarkers from blood. 14C-IODOACTAMIDE LABELING HUMAN GLYCOPROTEINS 2. Evaluating the performance of the original SPEG procedure using mouse plasma spiked with [14C]-labeled two human blood glycoproteins—AG and AT -1-acid glycoprotein 1 (AG) (Positive Control: 2 Cys in; 2 Cys out) MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES -1-antitrypsin (AT) (Negative Control: 0 Cys in; 1 Cys out) MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK REFERENCES [1] Hui Zhang, Xiao-jun Li, Daniel Martin and Ruedi Aebersold, Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nature Biotechnology. 2003, 21:660-666.

More Related