1 / 20

By Ahmad Mansour Mohamed Alzohairy

Utilization of bioinformatics in studying heat signaling. By Ahmad Mansour Mohamed Alzohairy. Department of Genetics, Zagazig University,Zagazig, Egypt 2005. Roughly, bioinformatics describes any use of computers to handle biological information.

chidi
Download Presentation

By Ahmad Mansour Mohamed Alzohairy

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Utilization of bioinformatics in studying heat signaling By Ahmad Mansour Mohamed Alzohairy Department of Genetics, Zagazig University,Zagazig, Egypt 2005

  2. Roughly, bioinformatics describes any use of computers to handle biological information.

  3. The Oxford English Dictionary defines crosstalk as : “Unwanted transfer of signals between communication channels” Oxford English Dictionary, 3rd edn. 2003 Oxford Press

  4. How Important are the signals?

  5. Search for heat signals الزهيرى

  6. HSF1 sequence BASE COUNT 480 a 313 c 381 g 451 t 1 ggcacgaggc tcccattaat atttcttctt ctgtgtaatt ccattattct gtagtagatt 61 cacgtccgag tttaaagaag agagaaaact gaaaaggcag aaaattccag agctttagat 121 ttagccaaag atagttatgg tcgtgttgtt cttggtgaag attggcaaag taggagccaa 181 tggaagaaac taagatcata atcaatcgcc ccaaaaacaa ccttgttcat tctatggttt 241 ttctcttcgg tttctatgtt tgggattggg aattcctcac tgtccttttg cttttcagtt 301 attgctcctt ctaattttcc ctagctagga tcttctcaat taatttcctt tttcattttc 361 aactaactca taattagccc aaatcttcaa aagagttttg tgtaagttga tagacgttta 421 gagaaacaga gaaatacagg ggaaaaacaa gggatgtcgc agaggacagt tccggcgccg 481 tttctgacga agacgtacca attggtagat gatgcgacca ccgacgacgt cgtatcttgg 541 aacgagagcg gcactacttt tgtggtttgg aaaactgctg aatttgcaaa ggatttggtg 601 cccacttact tcaagcacaa caatttctcc agcttcgttc gtcagcttaa cacttatggc 661 tttcgaaaga ttgtgccaga caaatgggaa ttcgccaacg agaacttcaa aagaggacag 721 aaggagctcc tcacggcaat acgccgtcgg aaaaccgtga caccaacccc agctggtggt 781 aagtccgtgg taccaggcac atcagcatct ccggacaatt cgggggaaga cttaggctca 841 agttccacct cttcccctga ctcgaagaac ccggggtctg ttgatactcc gggaaagtcc 901 caattcgcag acttgtcgga cgaaaacgag aagctaaaga aagacaacca gatgctgagc 961 tctgagctcg cgcaggccaa gaaacagtgc gacgagctag tggctttctt gaatcagtat 1021 gtgaaggttg cacctgacat gatcaaccgt atcattagcc aaggaacctc agggtccagc 1081 tatggggagt tggtcaagga ggtaattggt ggtgttaatg atttagaagc acaaggtagt 1141 gatgatgacg aaaagggtga tactttgaaa ctatttggtg tgttactgaa agagaacaag 1201 aaaaaaaggg gtccagacga gaatgctgat atttctgggt cccgtgggaa aatgatgaaa 1261 actatggact acaatttgcc ttggatgaaa atgtcttcgg cccctggaga gagtaacaag 1321 gtctgtaact gaaattgtga tccaaatatt aagggaagct agagaatgga cttctgcaga 1381 ttagcttcat gcatcctttt gttttagtgc ctgttagttt acaagttcag tgattatgaa 1441 ataacggagt atttagtatg agtagtattg gggttagatt actacgagca gtaaccccaa 1501 catattaaac aagaaatata tatacatagg ggactatcaa agtcatatcc cactgcctca 1561 aggtcggttg gtttgtgtag tccaaactca taataatggt ttcttattta tgatttcgtt 1621 ttggt

  7. The block diagram represents different elements of heat shock factor (HSF) in plants

  8. The Bioinformatics analysis of HSFs conserved domain among different species . A A B

  9. Prediction of HSF possible phosphorylation sites 292 Sequence MSQRTVPAPFLTKTYQLVDDATTDDVVSWNESGTTFVVWKTAEFAKDLVPTYFKHNNFSSFVRQLNTYGFRKIVPDKWEF 80ANENFKRGQKELLTAIRRRKTVTPTPAGGKSVVPGTSASPDNSGEDLGSSSTSSPDSKNPGSVDTPGKSQFADLSDENEK 160LKKDNQMLSSELAQAKKQCDELVAFLNQYVKVAPDMINRIISQGTSGSSYGELVKEVIGGVNDLEAQGSDDDEKGDTLKL 240FGVLLKENKKKRGPDENADISGSRGKMMKTMDYNLPWMKMSSAPGESNKVCN 320 .....................TT....S.................................................... 80....................T.T...............S...S......SS.SS..S.......T...S.....S..... 160............................Y............S...S..SY..................S.......T... 240....................S............................... 320 Phosphorylation sites predicted: Ser: 15 Thr: 6 Tyr: 2 The predicted phosphorylation sites in HSF 1 sequence using NetPhos 2.0. The positions of the phosphorylated amino acids HSF1 was estimated by computer based software using the amino acid sequence of the HSF1.

  10. HSP27 conserved domain search using CDART

  11. HSP27 3D

  12. The bioinformatics analysis of HSP70s DBD

  13. HSP70 3D High Resolution Solution Structure of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional NMR Techniques

  14. +T PIP2 + Membrane fluidity PLC cytoskeleton remodeling IP3 DAG Ca2+ channel opening Ca2+ influx vacuolar Ca2+ release DAGK CDPK activation PKC activation MAPK cascade (HAMK) PA +T HSFs Heat-specific gene expression Acquisition of heat tolerance Proposed model for Heat signaling in plants Mansour et al.

  15. Thank you

More Related