1 / 15

MODELLER hands-on

MODELLER hands-on. http://salilab.org/modeller/ Ben Webb, Sali Lab, UC San Francisco Maya Topf, Birkbeck College, London. Obtaining the Modeller software. Download the latest version (9v1) from our website: http://salilab.org/modeller/ For Mac, this will be the modeller-9v1.dmg file

katierosen
Download Presentation

MODELLER hands-on

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. MODELLER hands-on http://salilab.org/modeller/ Ben Webb, Sali Lab, UC San Francisco Maya Topf, Birkbeck College, London

  2. Obtaining the Modeller software • Download the latest version (9v1) from our website:http://salilab.org/modeller/ • For Mac, this will be the modeller-9v1.dmg file • But also available for Linux, Windows and some ancient Unix systems (Alpha, Solaris, AIX, IRIX) • To activate for academic use, fill out the license agreement; a license key will be emailed to you • The website also links to more detailed tutorials, the online manual, users’ mailing list, publications, etc.

  3. Running Modeller • Modeller is actually a powerful library of functions and Python classes for handling protein structures and alignments • Pro: not just limited to comparative modeling; you can add your own functionality (e.g. custom energy terms) in C or Python, or use the Python module from other programs • Pro: can also superpose structures, search sequence databases, fit against EM data, etc. • Con: there is no point and click interface; to build a model, you must write a short Python script… but for most applications, these scripts are very simple, and you can use the examples as your templates

  4. Running Modeller • Required inputs: • Target sequence (PIR format) • Template structure(s) (PDB format) • Python script file • Outputs: • Target-template alignment • PDB model file(s) • Log and data files (objective function and restraint violations) • (Optionally, you can find templates and/or build the alignment with another program and so skip the alignment step)

  5. Installation (1)

  6. Installation (2)

  7. Installation (3)

  8. Installation (4)

  9. Installation (5)

  10. Modeller example, step 1 • Example: build a model of one chain of the GroEL • Step 1: put the sequence in PIR format: >P1;1oel sequence:1oel: 1 ::522 ::undefined:undefined:-1.00:-1.00 AKDVKFGNDAGVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEV ASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTVAVEELKALSVPCSDSKAIAQVGTISA NSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKI SNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATAVVNTIRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVIS EEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVA VIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLR QIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDL* • Look up ‘alignment file format’ in the Modeller manual index for more information ‘align code’: an identifier used to identify the sequence. Often PDB code + chain ID (e.g. 1xyzA) type of sequence; often ‘structureX’ for X-ray structures, or ‘sequence’ for sequence only atom file name to read structural information from (usually the PDB code); unused in this case the amino acid sequence, terminated by a ‘*’ character

  11. Modeller example, step 1 • All Modeller input files are ‘plain text’ • I always work from a terminal window and use ‘vi’ to edit my text files, but… • emacs works too • If you want to use a graphical text editor, make sure you save the file in plain text (not Unicode) • For Mac’s TextEdit application, use ‘Make Plain Text’ from the Format menu • For Windows, use Notepad or be very careful to save in plain text otherwise (and watch out for Windows “helpfully” adding or hiding file extensions)

  12. Step 2: create Python script for target-template alignment from modeller import * env = environ() aln = alignment(env) mdl = model(env, file='1we3', model_segment=('FIRST:B','LAST:B')) aln.append_model(mdl, align_codes='1we3B', atom_files='1we3') aln.append(file='1oel.seq', align_codes='1oel') aln.align2d(max_gap_length=80) aln.write(file='1oel-1we3.ali', alignment_format='PIR')

  13. Step 3: run the script • Save the sequence as 1oel.seq, and the Python script as align2d.py • Also download the 1we3 structure from PDB, and put it in the same directory as the other two files • Both Modeller and Python are very strict about syntax – check that you have commas, brackets etc. in the right places • Open a terminal window (Linux) (on Mac/Windows, run the Modeller application which gives you a terminal window), then run with mod9v1 align2d.py • Any errors (Python exceptions) come out on standard error

  14. Step 4: build comparative models from modeller import * from modeller.automodel import * env = environ() a = automodel(env, alnfile='1oel-1we3.ali', knowns='1we3B', sequence='1oel', assess_methods=assess.DOPE) a.starting_model = 1 a.ending_model = 3 a.make() • Run in the same way as the alignment Python script earlier

  15. Step 5: view final models • On successful completion, the Modeller log file will contain details on the models, and 3 model files will be produced (1oel.B9999*.pdb) • Can be viewed in any PDB viewer, e.g. Chimera • Next steps to work on: • Fit a model into the EM density map to assess quality • Build models with a different template, with loop refinement • Fit new models and compare • See the README file in your input files directory • results directory contains the results (if you get stuck!)

More Related