1 / 40

The Generation of Retrogenic Mice

The Generation of Retrogenic Mice. MIG. Insertion: TCR alpha only or alpha_P2A_beta. Ψ. 5’LTR. SCID. pMIG. IRES. GFP. 3’LTR. Phoenix cells (293T cells transfected with pCL-Eco). CMV-env (Mo-MuLV) RSV-gag-pol (Mo-MuLV). SCID or C a -KO BM cells. pMIG. pMIG. pMIG.

marlo
Download Presentation

The Generation of Retrogenic Mice

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. The Generation of Retrogenic Mice MIG Insertion: TCR alpha only or alpha_P2A_beta Ψ 5’LTR SCID pMIG IRES GFP 3’LTR Phoenix cells (293T cells transfected with pCL-Eco) CMV-env (Mo-MuLV) RSV-gag-pol (Mo-MuLV) SCID or Ca-KO BM cells pMIG pMIG pMIG

  2. Anti-GAD TCR + or – B Lymphocytes TCR Retrogenic Induction High Levels GAD65Autoantibodies

  3. T Cell Islet Accumulation in Type 1 Diabetes is a Tightly Regulated, Cell-Autonomous Event Lennon et al Immunity 31, 643-653, 2009

  4. Unique autoreactive T cells recognize insulin peptides generated within the islets of Langerhans in autoimmune diabetes James F Mohan,…& Emil R Unanue Nature Immunology March 2010 InsulinomaType A Only islets + type B Rag-/- islets Type B CD11c islets Insulin granules

  5. Conserved T Cell Receptor Alpha Chain Induces Insulin Autoantibodies Kobayashi et al PNAS 105:10090-94 2008 Anti-B:9-23 TCR alpha Transgene No Transgene

  6. Nat Immunol. 2010 Mar;11(3):225-31. Epub 2010 Feb 7.Chromogranin A is an autoantigen in type 1 diabetes.Stadinski, …Kappler, Haskins Peptide WE14 bound to the NOD mouse major histocompatibility complex class II molecule I-A(g7) in an atypical manner, occupying only the carboxy-terminal half of the I-A(g7) peptide-binding groove.

  7. T Cell Receptor Gene Segments Antigen Presenting Cell HLA Molecule Peptide V J V D J Chr. 14 Chr. 6

  8. T cell Vb Va T cell receptor class I MHC b2m b cell Antigen Recognition by CD8+ T Cells T. DiLorenzo

  9. V(D)J Rearrangement 1011-1016 different possible combinations. Kuby Immunology

  10. Peptide Presentation Model AA Peptide Side Chains Peptide I-Ag7

  11. GROOVE “TEETH” TEETH T Cell Receptor Analogy

  12. Child with IPEX syndrome Awaiting Bone Marrow Transplant 9 Months of Age

  13. IPEX: Immune Dysfunction, Polyendocrinopathy, Enteropathy, X-linked • Scurfin gene (Foxp3/JM2)- Controls Regulatory T Cells! • Approximately 80% of children with syndrome develop diabetes! • Bone marrow transplant can reverse

  14. “Typical” Insulitis of man differs from peri-insulitis NOD mouse: Bottazzo

  15. t t t A MODEL b-cells APC ISLET Ag T cells Pancreatic Lymph Node Mathis/Benoist

  16. MAN NOD MOUSE TRAV5D-04+TRAJ53 Restriction? ? Insulin B:9-23: SHLVEALYLVCGERG? IAg7 DR3/DR4 Homann 2006,JCI Natural T Regulatory Cells Antigen Specific T Reg IPEX Syndrome MAN: foxP3 mutant DM in days of birth! NOD anti-B9-23insulin TCR: foxP3 mutant DM

  17. ENVIRONMENTAL FACTORS Incidence type 1 DM Increasing 3%/year > 30 years! Protective Factor Decreasing -Hygiene Hypothesis – Bach NEJM 347:911, 2002 Triggering Factors -Congenital Rubella-Rubenstein Diabetes 31:1088, 1982 -Kilham Rat Virus (BB-DR rat)-Zipris J. Immunol 174:131, 2005 -Poly-IC Induction Interferon Alpha-Devendra Diabetes 54 2005 -Dietary Factors-Scott Ann Rev Nutr 26:175, 2006

  18. Natural T Regulatory Cells Antigen Specific T Reg T Cell Receptor

  19. Amino Acid Sequence of Mouse 1 and 2 and Human Insulin Leader 1: MAL LVHFLPLLALLALWEPKPTQA Leader 2: MALWMRFLPLLALLFLWESHPTQA Human : MALWMRLLPLLALLALWGPDPAAA 10 20 B Chain 1: FVKQHLCGPHLVEALYLVCGERGFFYTPKS B Chain 2: FVKQHLCGSHLVEALYLVCGERGFFYTPMS Human : FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 30 40 50 C-Peptide 1: RREVEDPQVEQLELGGSPG…..DLQTLALEVARQ C-Peptide 2: RREVEDPQVAQLELGGGPGAGDLQTLALEVAQQ Human : RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQ 55 60 70 80 A Chain 1: KR GIVDQCCTSICSLYQLENYCN A Chain 2: KR GIVDQCCTSICSLYQLENYCN Human : KR GIVEQCCTSICSLYQLENYCN 88 100 B:9-23

  20. Lack of progression to diabetes of NOD mice lacking both insulin native genes. 25 25 21 23 10 14 2 4 1 1 Ins1-, ins2-: n= Ins1+, ins2-: n= Life table update 5/19/05 Nakayama Nature 435:220,2005

  21. Insulin specific T cells Insultis Epitope and antigen spreading, expansion Diabetes Insulin is the primary antigen and precedes IGRP in hierarchy of autoantigens Krishnamurthy et al JCI:116:3258, 2006

  22. Is there a primary antigen or immune response to multiple antigens required for autoimmunity? T cells specific for multiple antigens T cells specific for one antigen Insulitis Insulitis OR Epitope and antigen spreading, expansion Expansion of T cells Diabetes Diabetes Krishnamurthy et al JCI:116:3258, 2006

  23. Natural peptides selected by diabetogenic DQ8 and murine I-Ag7 molecules show common sequence homology Suri et al JCI 115:2268, 2005Structure of Human insulin peptide DQ8, Lee et al Nature Immunology 6:501, 2001 Crystal DQ8;B:9-23: S H L V E A L Y L V C G E R G Wiley Nat Immunol P1 P4 P6 P9 Preferred AA in Bound Peptides I-Ag7 v,e,q I,L A,s D,E 12% 20% 30,11% 45% DQ8 E,d A,S A,V,s E,D 27,17% 19% 20% 60,25% % amino acid at position

  24. NOD Mouse anti-islet T Cell Clones/transgenics/retrogenics

  25. Hafler DRB1*0401 A1-15 Peakman DRB1*0401 C19-A3 Peakman A2 CD8 PPI:15-24 Gottlieb B:9-23 DQ8 Durinovic-Bello DRB1*0401 CD4 73-90

  26. Expanded T cells from pancreatic lymph nodes of type 1 diabetic subjects recognize an insulin epitopeKent et al, Nature 435:224, 2005 • Pancreatic LN: Single cell cloning - PHA • 2/3 Patients Clonal expansion duration diabetes 29 and 15 years • Vbeta29-1*03J2-3(50%)/Valpha8-3*02 J44*01(25%)Vbeta5-1*01 J2-3(52%)/Valpha39*01 J33*01(26%) • DRB1*0401 RestrictedInsulin A1-15 • Caveat: High concentration to stimulate 100uM BDC

  27. The insulin A-chain epitope recognized by human T cells is posttranslationally modifiedMannering et al, JEM 202:1191-1197, 2005 • CD4 T cells cloned with CFSE method from peripheral blood of one patient with diabetes and one child with insulin autoantibodies • Subset of the clones reacted with insulin A-chain 1-13 epitope • T Cells DR restricted and only reacted with peptide with vicinal disulfide bond between adjacent cysteines A6 and A7 • No reactivity with this peptide of clones from two normal controls with DR4 • Oral report by Sally Kent that their A1-15 peptide reactive T cells from pancreatic lymph node do not require vicinal disulfide cross-link

  28. Ins2 deficiency augments spontaneous HLA-A*0201-restricted T cell responses to Insulin Jarchum and DiLorenzo J Immunol 2010 vol 184 Humanized HLA-A2 Mice lacking Insulin 2! Ins B:10-18 CD8 Elispot

  29. Thymus-specific deletion of insulin induces autoimmune diabetes.Fan et al EMBO Journal 28:2812-2824 2009 • Ins1-/- mice (only) with cre mediated thymic mTEC deletion of ins2 develop autoimmune diabetes by age 3 weeks. • Diabetes develops in H-2b mice! • ELISPOT Responses to Insulin B:9-23 though mice do not have I-Ag7. • MYSTERIES: Need for Ins1-/-; Lack protection H-2b; Presentation B:9-23 by H-2b.

  30. The frequency and immunodominance of Islet-specific CD8+ T-cell responses change after Type 1 Diabetes Diagnosis and Treatment Martinuzzi et al Diabetes 57:1312-1320, 2008 7-16 months post onset most ELSIPOT (HLA-A2) responses decrease PREPROINSULIN PROINSULIN New Responses

  31. “Santamria” NRP(IGRP206-214): Class I (Kd)Recognized Peptide • CD8 T cell from NOD islets (e.g. clone 8.3) • Conserved Valpha/ nDn/ J alpha (Va17,Ja42)Vbeta not conserved but contributes • Accelerated diabetes TCR Transgenic • Mimotope Defined-Kd Tetramer ProducedNRP=KYNKANWFL; NRP-V7: KYNKANVFL • Higher Avidity Peptide/Tetramer V7 • 30% Intra-islet post 9 weeks>.5% in Blood Predicts Diabetes NOD Mice

  32. % NRP-V7 tetramer+ CD8+ cells % NRP-V7 tetramer+ CD8+ cells Age (weeks) Age (weeks) Tan et al., JCI 1/2003 Female NOD Mice Peripheral Blood Kd NRP-V7 Peptide (KYNKANVFL) Tetramer Analysis Avidin Kd Kd Kd Diabetes No Diabetes

  33. CTLs are targeted to kill β cells in patientswith type 1 diabetes through recognition ofa glucose-regulated preproinsulin epitope Ania Skowera,…. and Mark Peakman JCI 2008:118 3268-3271. Interferon gamma HLA-A2 ELISPOT peripheral blood Patients+ (SI>3) DM vs Controls

  34. CD8+ CTL CTL Screening of Peptide Fractions by 51Cr Release Cytotoxicity Assay Method Used to Discover IGRP APC T. DiLorenzo

  35. Antigens for CD8+ T Cells in Type 1 Diabetes Patients DiLorenzo GAD, glutamic acid decarboxylase; IAPP, islet amyloid polypeptide

  36. Antigens for Islet-infiltrating CD8+ T Cells in NOD Mice DMK, dystrophia myotonica kinase GAD, glutamic acid decarboxylase IGRP, islet-specific glucose-6-phosphatase catalytic subunit-related protein DiLorenzo

  37. Toma et al. Recognition of a subregion of human proinsulin by class I-restricted T cells in type 1 diabetic patients PNAS 102:10581, 2005 • Selected 8-11mer peptides of proinsulin • PBMCs of 29/32 (90%) recent+long term diabetics responded IFNgamma in ELISPOT assay versus minimal response of normals • Significant Peptides often overlapped insulin B chain peptide B:9-23(=Proins 33-47); Proins 34-42(B10-18); Proins 41-50(B17-26);Proins 42-51;Prins44-51; but also B chain-C-peptide (49-57) • Multiple class I alleles, including A1 and B8

  38. T cell epitopes on the diabetes autoantigen Phogrin (IA-2beta) are conserved among different species C terminus TM PTP N terminus Peptide 2: Amino acids 643-658 Peptide 7: Amino acids 762-777 GADPSADATEAYQEL (rat) GADPSADATEAYQEL (mouse) GGDPGADATAAYQEL (human) KNRSLAVLTYDHSRI (rat) KNRSLAVLTYDHSRI (mouse) KNRSLAVLTYDHSRV (human)

More Related