1 / 13

Hox Genes Control the Vertebrate A-P Axis

Hox Genes Control the Vertebrate A-P Axis. Homeodomain protein. A homeobox is about 180 base pairs long and encodes a protein domain that binds DNA with the nucleotide sequence TAAT.. RRRKRTA-YTRYQLLE-LEKEFLF NRYLTRRRRIELAHSL-NLTERHIKIWFQNRRMKWKKEN. The modular construction of plants.

rebeccajenkins
Download Presentation

Hox Genes Control the Vertebrate A-P Axis

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Hox Genes Control the Vertebrate A-P Axis

  2. Homeodomain protein • A homeobox is about 180 base pairs long and encodes a protein domain that binds DNA with the nucleotide sequence TAAT.. • RRRKRTA-YTRYQLLE-LEKEFLF NRYLTRRRRIELAHSL-NLTERHIKIWFQNRRMKWKKEN

  3. The modular construction of plants

  4.  The size of the meristem is controlled by a self-regulating balance between a short-range stimulatory signal produced by cells expressing Wuschel(yellow arrow), and a longer-range inhibitory signal delivered by Clavata3 (red bars).

  5. Domestication of maize and fish

  6. A Hierarchy of Inductive Interactions Subdivides the Vertebrate Embryo

  7. http://www.nature.com/nrm/journal/v7/n4/extref/nrm1855-s1.avihttp://www.nature.com/nrm/journal/v7/n4/extref/nrm1855-s1.avi

More Related