1 / 5

EGFR binding + D-K 6 L 9 lytic peptide

A. B. EGFR binding + D-K 6 L 9 lytic peptide. EGFR binding + Newly designed lytic peptide. YHWYGYTPQNVIGGG KL L LK L L KK LLK L LKKK. YHWYGYTPQNVIGGGLK L LK K L LK KLL K LL-NH 2. C. D. EGFR-D-K 6 L 9 peptide. EGFR-lytic peptide. [θ] (deg cm 2 dmol -1 ). Wave length (nm).

yin
Download Presentation

EGFR binding + D-K 6 L 9 lytic peptide

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. A B EGFR binding + D-K6L9 lytic peptide EGFR binding + Newly designed lytic peptide YHWYGYTPQNVIGGG KLLLKLLKKLLKLLKKK YHWYGYTPQNVIGGGLKLLKKLLKKLLKLL-NH2 C D EGFR-D-K6L9 peptide EGFR-lytic peptide [θ] (deg cm2 dmol-1) Wave length (nm) Wave length (nm) [θ] (deg cm2 dmol-1) PC SUVs PC SUVs PC/PS SUVs PC/PS SUVs Fig. S1. (A)-(D) Kohno et al.

  2. A MRC-5 H322 ● EGFR-D-K6L9 ○ D-K6L9 Cell viability (% control) Peptide (mM) Peptide (mM) B ● EGFR-lytic ○ D-K6L9 BT-20 HC Cell viability (% control) Peptide (mM) Peptide (mM) Fig. S2. (A)-(B) Kohno et al.

  3. A Start injection Stop injection 27mM-chimeric peptide Response 13mM-chimeric peptide 24mM-lytic peptide 12mM-lytic peptide B Time (s) H322 H322 MRC-5 Response Response 0.1mg/ml 0.1mg/ml 0.05mg/ml 0.05mg/ml 0.025mg/ml 0.025mg/ml C Time (s) Time (s) H322 MRC-5 0.1mg/ml Response Response 0.05mg/ml 0.025mg/ml Fig. S3. (A)-(C) Kohno et al. Time (s) Time (s)

  4. D Fig. S3. (D) Kohno et al.

  5. Lytic-TAMRA Calcein-green 50mm TAMRA-red 50mm DIC 50mm 0 min 2 min 5 min 10 min 20 min Fig. S4. Kohno et al.

More Related