1 / 10

Can Halorabdus utahensis secrete proteins? A. Malcolm Campbell

Can Halorabdus utahensis secrete proteins? A. Malcolm Campbell. Halorabdus utahensis habitat. Halorabdus utahensis habitat. 28% w/v NaCl in Gunnison Bay excludes many species Brine shrimp reproduce in low salt areas of Gunnison Bay

kassia
Download Presentation

Can Halorabdus utahensis secrete proteins? A. Malcolm Campbell

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Can Halorabdus utahensis secrete proteins? A. Malcolm Campbell

  2. Halorabdus utahensis habitat

  3. Halorabdus utahensis habitat

  4. 28% w/v NaCl in Gunnison Bay excludes many species • Brine shrimp reproduce in low salt areas of Gunnison Bay • Brine shrimp feed on algae with cell walls of cellulose and other • complex sugars • Shrimp in main body of Gunnison Bay die • Brine flies inhabit the shoreline http://ut.water.usgs.gov/greatsaltlake/

  5. Translation with Secretion Albert Bolhuis. 2004. Phil. Trans. R. Soc. Lond. B. Vol. 359: 919–927.

  6. Translation with Secretion Signal peptidase I (EC 3.4.21.89) Albert Bolhuis. 2004. Phil. Trans. R. Soc. Lond. B. Vol. 359: 919–927.

  7. Translation then Secretion Tat proteins use protein domain of SRRXFLK to be targeted to be exported Figure from Sonja-Verena Albers, Zalán Szabó and Arnold J. M. Driessen. 2006. Nature Reviews: Microbiology. VOLUME 4.

  8. Translation then Secretion Tat proteins use protein domain of SRRXFLK to be targeted to be exported Figure from Sonja-Verena Albers, Zalán Szabó and Arnold J. M. Driessen. 2006. Nature Reviews: Microbiology. VOLUME 4.

  9. Translation then Secretion Tat (twin arginine targeting proteins) use protein domain of SRRXFLK to be targeted to be exported ✔cellulase (glycosyl hydrolase family 5) MTDPDRPPTGDREASQSNTTTGGEGPSRRTFLK… ✔ phage tail protein, P2 protein I family MTRRTNDTGEVDEKPSSGAEQQGSNDSTGSRDPSRRDFLK... ✔ candidate polyfunctional acetylxylan esterase-B-xylosidase-a-L-arabinofuranosidase, glycoside hydrolase Family 43 protein and Carbohydrate Esterase Family 6 protein – MTRRTNDTGEVDEKPSSGAEQQGSNDSTGSRDPSRRDFLK… ✔ Endoglucanase MTHNNPDDDSTARRTTESTESPSTAGIASASRRDFLK... ✔ Exocellobiohydrolase A/1,4-beta-cellobiohydrolase A MTHNNPDDDSTARRTTESTESPSTAGIASASRRDFLK ✔ Cellulase (glycosyl hydrolase family 5)./Fibronectin type III domain MTDEATESIEASATDHTDETAGNRKDPGLTSSRRTFLG...

  10. + =

More Related