Supplemental figure 1

Aug 15, 2014

10 likes | 100 Views

Supplemental figure 1. A B C D. PA, TMA, AOO. Days 1 8 15 22 23. Sacrifice. OVA, gelatin, PBS. Days 1 8 15 22 23. Sacrifice. DPE, PBS. Days 1 8 15 22 23. Sacrifice.

Share Presentation

Embed Code

Link

supplemental figure
pbs days
sacrifice pollen
aoo days

carney

Download Presentation

Supplemental figure 1

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Supplemental figure 1 A B C D PA, TMA, AOO Days 1 8 15 22 23 Sacrifice OVA, gelatin, PBS Days 1 8 15 22 23 Sacrifice DPE, PBS Days 1 8 15 22 23 Sacrifice Pollen, cockroach, PBS Days 1 8 15 22 28 29 Sacrifice

Supplemental Figure 1

2500. 2000. 1500. 1000. 500. Supplemental Figure 1. CS-0777 product [ ng/mL ･ mg protein ]. 0. #1. #2. #3. #4. #5. Human specimen number. Supplemental figure 1. Examination of individual specificity of CS-0777-P phosphatase activity

259 views • 7 slides

Supplemental Figure 1

Supplemental Figure 1. A. Mock. MOI-100. MOI-10. 0.5%. 79.7%. 21.8%. CD3 PerCP. NY-ESO-1 Tetramer PE. B. C. Supplemental Figure 2. A. Thymus. L Humerus. R Humerus. Muscle. L Femur. R Femur. C. B. P < 0.0001. Supplemental Figure 3. A. B.

164 views • 3 slides

Supplemental Figure 1

Supplemental Figure 1. Isolation of glomeruli in control mice.

112 views • 1 slides

Supplemental Figure 1

A. B. C. D. E. F. Supplemental Figure 1. Supplemental Figure S1. Incidence of CD4+ IFN γ (A) , IL-2 (C) and TNFa (E) responders and magnitude of total IFN γ + (B), IL-2+ (D) and TNFa+ (F) CD4+ T-cell responses in different patient groups

154 views • 6 slides

Supplemental Figure 1

Supplemental Figure 1. Patient 2. Supplemental Figure 2. Patient:. 1. 2. 3. No cDNA. No cDNA. No cDNA. - Ac. - Ac. - Ac. - Ac. - Ac. - Ac. IgG. IgG. IgG. IgG. IgG. IgG. IgA. IgA. IgA. IgA. IgA. IgA. Patient:. 4. 5. 6. No cDNA. - Ac. - Ac. - Ac. - Ac.

108 views • 4 slides

Supplemental Figure 1

Supplemental Figure 1. c. . MGC-803. 4. 4. 3. 3. miR-185 levels (fold). 40. TUNEL positive cells (%). 2. 2. . 1. 1. 20. 0. 0. . 60. 60. 0. –. CDDP(30 m M). +. +. +. TUNEL positive cells (%). 40. 40. . –. –. –. miR-185 AntagomiR. +. –. –. –.

80 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1. B. A. g H2AX. TRF1. Merge. 100. Untreated. 80. 60. % of TIFs positive cells. 40. RHPS4. 20. 0. _. RHPS4. siTRF2. siPOT1. CPT. IR. siTRF2. siPOT1. CPT. IR.

117 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1. Supplemental Figure 1 . Southern of AtplaIVC-1

86 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1. Supplemental Figure 2. Supplemental Figure 3. A. B. C. D. Supplemental Figure 4. A. B. 231. 231. C. D. 231-Ecad. 231-Ecad. E. F. 231-shEcad. 231-shEcad. G. H. DU-145. DU-145. Supplemental Figure 5. Supplemental Figure 6. Supplemental Figure 7. A.

166 views • 10 slides

Supplemental Figure 1

Supplemental Figure 1. IIa. hIL6 MNSFSTSAFGPVAFSLGLLLVLPAAFP APVPPGEDSKDVAAPHRQPLT SSERIDKQIRYI vIL6 ----- MCWFKLWSLLLVGSLLVSGTRG -------------KLPDAPEF EKDLLIQRLNWM hIL6 LDGISALRKETC NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFN EETCLVKIITGLL

96 views • 4 slides

Supplemental Figure 1

Supplemental Figure 1. True leaf from 2 nd to 7 th nodes. (a). M. 1 st (IN) IN. 2 nd. 3 rd. 4 th. 5 th. 6 th. 7 th. PC. ALSV-RNA2. 7. PsEF1- a. 6. 1. 2. 3. 5. True leaf from 2 nd to 7 th nodes. ALSV inoculation. 4. 2 nd. 3 rd. 4 th. 5 th. 6 th. 7 th. 3. Mock. 2.

99 views • 3 slides

Supplemental Figure 1

Vimentin. FLAG/Luc/#1. FLAG/Keap1/#1. FLAG/Luc/#1 FLAG/Keap1/#1. B. Supplemental Figure 1. A. Supplemental Figure 2. GSH. 25,000,000. 20,000,000. Relative Intensity. 15,000,000. 10,000,000. 5,000,000. 0. Control. Nrf2 shRNA/#2. Levels of ROS. A. B. Control.

217 views • 10 slides

Supplemental figure 1

Supplemental figure 1. A. B. LFN. naked DNA. C. D. 【 Ad genome 】. 【 pDNA 】. Amount of DNA. Amount of DNA. ( ×10 9 copies). ( ×10 10 copies). 1.1. 2.1. 4.3. 0.85. 1.7. 3.4. 6.8. E. F. 【 Ad genome 】. 【 pDNA 】. 25. 60. y = 8.0×10 -10 x + 0.030 R 2 = 0.989.

84 views • 2 slides

Supplemental Figure 1

S IVSI-110 CD39 IVSI-1.

77 views • 1 slides

Supplemental figure 1

2.5. *. 2.0. 1.5. LC3-II protein level. 1.0. 0.5. Ctrl. Pi. Supplemental figure 1. a. b. Ctrl Pi (3 mM). LC3I. LC3II. 50.  -actin. *. 40. 30. %Cells with GFP-LC3 puncta. 20. 10. Ctrl. Pi.

193 views • 7 slides

Supplemental Figure 1

Supplemental Figure 1. Events. Events. Events. Events. HLA-A2. CD137L. CD64. HLA-DR15. K562. Events. Events. aAPC. CD80. CD83. Supplemental Figure 2. CD3. FSC-H. FSC-A. CD14 , CD19, Vivid. SSC. CD4. CD8. FSC-A. Supplemental Figure 3. B. A. Fold expansion.

203 views • 4 slides

Supplemental Figure 1

Supplemental Figure 1. The vast majority of alterations are shared between primary and metastatic tumors. Of the 434 total mutations, 344 (79%) were shared between patient-matched tumors (purple dots). Mutations private to primary are in pink, and mutations private to metastasis are in blue.

210 views • 6 slides

Supplemental figure 1

Wing. 40. 30. 20. 10. 70. Dufour’s gland. 60. 50. 40. 30. 20. 10. 0. B. lucorum F. B. terrestris. B. terrestris type II. B. pascuorum. B. lucorum UK. B. hortorum. Proportion of each alkane. B. pratorum. B. jonellus. B. lapidarius. B. monticola. B. muscorum.

77 views • 1 slides

Supplemental Figure 1.

Supplemental Figure 1. Immunohistochemistry for Hic-5 in human small intestine. In the epithelial cells, Hic-5 appears to be localized primarily in the apical portion of the epithelium.

85 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1.

85 views • 1 slides

Supplemental Figure 1

B. Axonal Blebbing. t = 0 min. t = 0 min. t = 5 min. t = 5 min. t = 10 min. t = 10 min. t = 15 min. t = 15 min. t = 20 min. t = 20 min. A. Growth Cone Ruffling. D. Average Positive Particle Velocity Histogram. C. WGA Kymograph (4 hr incubation). 0 min. Time. *. 20 min.

199 views • 2 slides

Supplemental Figure 1

Supplemental Figure 1. 0. LNCaP/Luc/PHB-siRNA. b. No Dox No DHT. No Dox No DHT. No Dox + DHT. *. No Dox + DHT. 20. 1.4. PHB-RNAi No DHT. PHB-RNAi No DHT. *. PHB-RNAi + DHT. PHB-RNAi + DHT. 1.2. *. 15. 1. *. Fold Enrichment of AR. 0.8. Fold Enrichment of PHB. 10. 0.6. 0.4.

111 views • 9 slides

More Related