Supplemental Figure 1

Aug 25, 2014

10 likes | 108 Views

Supplemental Figure 1. 3 H-Thymidine incorporation ( Δ CPM×10 -3 ). Events. ILT2. ILT4. KIR2DL4. CD160. HLA-G Nanoparticles ×10 -3 / cell. Ø. Ctrl. HLA-G. 24h. G0/G1. G0/G1. G0/G1. S. S. S. G2/M. G2/M. Cell counts. G2/M. DNA content. 48h. G0/G1. G0/G1. G0/G1. S. S. S.

Share Presentation

Embed Code

Link

thymidine incorporation
dna content
g 24h
g cell
cyclin d1
g2 m dna

creda

Download Presentation

Supplemental Figure 1

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Supplemental Figure 1 3H-Thymidine incorporation (ΔCPM×10-3) Events ILT2 ILT4 KIR2DL4 CD160 HLA-G Nanoparticles×10-3/ cell Ø Ctrl HLA-G 24h G0/G1 G0/G1 G0/G1 S S S G2/M G2/M Cell counts G2/M DNA content 48h G0/G1 G0/G1 G0/G1 S S S Cell counts G2/M G2/M G2/M DNA content a b c d f e 16h 24h 6h Ctrl HLA-G Cell counts Cyclin D1

Supplemental Figure 1

2500. 2000. 1500. 1000. 500. Supplemental Figure 1. CS-0777 product [ ng/mL ･ mg protein ]. 0. #1. #2. #3. #4. #5. Human specimen number. Supplemental figure 1. Examination of individual specificity of CS-0777-P phosphatase activity

258 views • 7 slides

Supplemental Figure 1

Supplemental Figure 1. A. Mock. MOI-100. MOI-10. 0.5%. 79.7%. 21.8%. CD3 PerCP. NY-ESO-1 Tetramer PE. B. C. Supplemental Figure 2. A. Thymus. L Humerus. R Humerus. Muscle. L Femur. R Femur. C. B. P < 0.0001. Supplemental Figure 3. A. B.

163 views • 3 slides

Supplemental Figure 1

Supplemental Figure 1. Isolation of glomeruli in control mice.

109 views • 1 slides

Supplemental Figure 1

A. B. C. D. E. F. Supplemental Figure 1. Supplemental Figure S1. Incidence of CD4+ IFN γ (A) , IL-2 (C) and TNFa (E) responders and magnitude of total IFN γ + (B), IL-2+ (D) and TNFa+ (F) CD4+ T-cell responses in different patient groups

152 views • 6 slides

Supplemental Figure 1

Supplemental Figure 1. Patient 2. Supplemental Figure 2. Patient:. 1. 2. 3. No cDNA. No cDNA. No cDNA. - Ac. - Ac. - Ac. - Ac. - Ac. - Ac. IgG. IgG. IgG. IgG. IgG. IgG. IgA. IgA. IgA. IgA. IgA. IgA. Patient:. 4. 5. 6. No cDNA. - Ac. - Ac. - Ac. - Ac.

105 views • 4 slides

Supplemental Figure 1

Supplemental Figure 1. c. . MGC-803. 4. 4. 3. 3. miR-185 levels (fold). 40. TUNEL positive cells (%). 2. 2. . 1. 1. 20. 0. 0. . 60. 60. 0. –. CDDP(30 m M). +. +. +. TUNEL positive cells (%). 40. 40. . –. –. –. miR-185 AntagomiR. +. –. –. –.

78 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1. B. A. g H2AX. TRF1. Merge. 100. Untreated. 80. 60. % of TIFs positive cells. 40. RHPS4. 20. 0. _. RHPS4. siTRF2. siPOT1. CPT. IR. siTRF2. siPOT1. CPT. IR.

117 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1. Supplemental Figure 1 . Southern of AtplaIVC-1

83 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1. Supplemental Figure 2. Supplemental Figure 3. A. B. C. D. Supplemental Figure 4. A. B. 231. 231. C. D. 231-Ecad. 231-Ecad. E. F. 231-shEcad. 231-shEcad. G. H. DU-145. DU-145. Supplemental Figure 5. Supplemental Figure 6. Supplemental Figure 7. A.

165 views • 10 slides

Supplemental Figure 1

Supplemental Figure 1. IIa. hIL6 MNSFSTSAFGPVAFSLGLLLVLPAAFP APVPPGEDSKDVAAPHRQPLT SSERIDKQIRYI vIL6 ----- MCWFKLWSLLLVGSLLVSGTRG -------------KLPDAPEF EKDLLIQRLNWM hIL6 LDGISALRKETC NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFN EETCLVKIITGLL

95 views • 4 slides

Supplemental Figure 1

Supplemental Figure 1. True leaf from 2 nd to 7 th nodes. (a). M. 1 st (IN) IN. 2 nd. 3 rd. 4 th. 5 th. 6 th. 7 th. PC. ALSV-RNA2. 7. PsEF1- a. 6. 1. 2. 3. 5. True leaf from 2 nd to 7 th nodes. ALSV inoculation. 4. 2 nd. 3 rd. 4 th. 5 th. 6 th. 7 th. 3. Mock. 2.

98 views • 3 slides

Supplemental Figure 1

Vimentin. FLAG/Luc/#1. FLAG/Keap1/#1. FLAG/Luc/#1 FLAG/Keap1/#1. B. Supplemental Figure 1. A. Supplemental Figure 2. GSH. 25,000,000. 20,000,000. Relative Intensity. 15,000,000. 10,000,000. 5,000,000. 0. Control. Nrf2 shRNA/#2. Levels of ROS. A. B. Control.

216 views • 10 slides

Supplemental figure 1

Supplemental figure 1. A. B. LFN. naked DNA. C. D. 【 Ad genome 】. 【 pDNA 】. Amount of DNA. Amount of DNA. ( ×10 9 copies). ( ×10 10 copies). 1.1. 2.1. 4.3. 0.85. 1.7. 3.4. 6.8. E. F. 【 Ad genome 】. 【 pDNA 】. 25. 60. y = 8.0×10 -10 x + 0.030 R 2 = 0.989.

81 views • 2 slides

Supplemental Figure 1

S IVSI-110 CD39 IVSI-1.

77 views • 1 slides

Supplemental figure 1

2.5. *. 2.0. 1.5. LC3-II protein level. 1.0. 0.5. Ctrl. Pi. Supplemental figure 1. a. b. Ctrl Pi (3 mM). LC3I. LC3II. 50.  -actin. *. 40. 30. %Cells with GFP-LC3 puncta. 20. 10. Ctrl. Pi.

192 views • 7 slides

Supplemental Figure 1

Supplemental Figure 1. Events. Events. Events. Events. HLA-A2. CD137L. CD64. HLA-DR15. K562. Events. Events. aAPC. CD80. CD83. Supplemental Figure 2. CD3. FSC-H. FSC-A. CD14 , CD19, Vivid. SSC. CD4. CD8. FSC-A. Supplemental Figure 3. B. A. Fold expansion.

199 views • 4 slides

Supplemental Figure 1

Supplemental Figure 1. The vast majority of alterations are shared between primary and metastatic tumors. Of the 434 total mutations, 344 (79%) were shared between patient-matched tumors (purple dots). Mutations private to primary are in pink, and mutations private to metastasis are in blue.

210 views • 6 slides

Supplemental figure 1

Wing. 40. 30. 20. 10. 70. Dufour’s gland. 60. 50. 40. 30. 20. 10. 0. B. lucorum F. B. terrestris. B. terrestris type II. B. pascuorum. B. lucorum UK. B. hortorum. Proportion of each alkane. B. pratorum. B. jonellus. B. lapidarius. B. monticola. B. muscorum.

77 views • 1 slides

Supplemental Figure 1.

Supplemental Figure 1. Immunohistochemistry for Hic-5 in human small intestine. In the epithelial cells, Hic-5 appears to be localized primarily in the apical portion of the epithelium.

83 views • 1 slides

Supplemental Figure 1

Supplemental Figure 1.

84 views • 1 slides

Supplemental Figure 1

B. Axonal Blebbing. t = 0 min. t = 0 min. t = 5 min. t = 5 min. t = 10 min. t = 10 min. t = 15 min. t = 15 min. t = 20 min. t = 20 min. A. Growth Cone Ruffling. D. Average Positive Particle Velocity Histogram. C. WGA Kymograph (4 hr incubation). 0 min. Time. *. 20 min.

197 views • 2 slides

Supplemental Figure 1

Supplemental Figure 1. 0. LNCaP/Luc/PHB-siRNA. b. No Dox No DHT. No Dox No DHT. No Dox + DHT. *. No Dox + DHT. 20. 1.4. PHB-RNAi No DHT. PHB-RNAi No DHT. *. PHB-RNAi + DHT. PHB-RNAi + DHT. 1.2. *. 15. 1. *. Fold Enrichment of AR. 0.8. Fold Enrichment of PHB. 10. 0.6. 0.4.

111 views • 9 slides

More Related