1 / 8

Salmon Calcitonin

Salmon Calcitonin. Drugbank ID : DB00017 Protein chemical formula : C 145 H 240 N 44 O 48 S 2 Protein average weight : 3431.8530 Half life : 50-80 minutes. Description : Synthetic peptide, 32 residues long formulated as a nasal spray. Indication :

ryals
Download Presentation

Salmon Calcitonin

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Salmon Calcitonin Drugbank ID : DB00017 Protein chemical formula : C145H240N44O48S2 Protein average weight : 3431.8530 Half life : 50-80 minutes

  2. Description: Synthetic peptide, 32 residues long formulated as a nasal spray. Indication : For the treatment of post-menopausal osteoporosis Pharmacodynamics: Calcitonin inhibits bone removal by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. This leads to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.

  3. Mechanism of action : Calcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylylcyclase and the phosphatidyl-inositol-calcium pathway. Metabolism : Salmon calcitonin is primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. Absorption : Salmon calcitonin is rapidly absorbed and eliminated. Bioavailability following subcutaneous and intramuscular injection in humans is high and similar for the two routes of administration (71% and 66%, respectively).

  4. Route of Elimination : Studies with injectablecalcitonin show increases in the excretion of filtered phosphate, calcium, and sodium by decreasing their tubular reabsorption in the kidney. Toxicity : Salmon calcitonin is devoid of embryotoxic, teratogenic and mutagenic potential. Targets : Calcitonin receptor Affected organisms : Humans and other mammals

  5. Categories : Bone Density Conservation Agents and Antihypercalcemic Agents and Anti-Osteporotic Agents Patents : Country Patent Number Approved Expires United States 6440392 2001-02-02 2021-02-02 United States 5733569 1995-03-31 2015-03-31 Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

  6. Brands : Calcimar Description : Calcitonin is a group of polypeptide hormones secreted by the thyroid gland in mammals and by the ultimobranchial gland of birds and fish. It is of physiological importance in the regulation of calcium metabolism in certain animal species, and may also have physiological importance in certain extra skeletal systems Used for/Prescribed for : Calcitonin injection is used to treat Paget's disease of bone, postmenopausal osteoporosis, or high levels of calcium in the blood (hypercalcemia). Formulation : Each mL of sterile solution contains: calcitonin salmon 200 IU. Nonmedicinal ingredients: acetic acid, phenol, sodium acetate, sodium chloride, sodium hydroxide and water for injection. Form : solution Route of administration : subcutaneous or intramuscular injection

  7. Dosage :the dose of calcitonin is based on body weight and injected every 12 hours Contraindication : allergy Side effects : feeling light-headed, fainting; or muscle stiffness. Drug interaction :A total of 5 drugs (43 brand and generic names) are known to interact with calcitonin among which 2 moderate drug interactions (9 brand and generic names) and 3 minor drug interactions

  8. References :http://www.drugs.com/sfx/calcimar-side-effects.html http://www.drugs.com/drug-interactions/calcitonin-index.html?filter=1 http://www.rxmed.com/b.main/b2.pharmaceutical/b2.1.monographs/CPS-%20Monographs/CPS-%20%28General%20Monographs-%20C%29/CALCIMAR.html

More Related